The EnchantedForestfragranceisadelightfulblendoffresh,lushgreennoteswithhintsofearthinessandexoticflorals.Itcapturestheessenceofavibrantrainforest,radiatingasenseoftranquilityandnaturalbeauty.Thetopnotesofthe EnchantedForestfragrancearefilledwiththeinvigoratingscentofrain-soakedleavesandvibrantgreenery.Thisinitialburstoffreshnessisreminiscentofawalkthroughadenseforestfilledwithlife.Asthefragrancedevelops,theheartnotesrevealaplethoraofexoticflorals.Notesofjasmineandwildorchidsaddatouchofeleganceandsensuality,whiletropicalbloomslikefrangipaniandylang-ylangtransportyoutotheheartoftherainforest.
Our sprays are 100% Concentrated so less is more! For best results and safe use, spray product in air and make sure to spray away from fabric, material, or any surface. If using this product in a vehicle, please use with caution. Spray in a downward angle, towards the floorboards (under floor mats). Keep bottle upright at all times. Store in a cool and dry place.
Incense (Small & Jumbo):
To ignite Blunteffects® Incense Sticks properly, ensure that you are holding the thinner wood of the incense stick and lighting the thicker part. Ignite the thicker end with a lighter for safe use. Make sure to hold incense stick away from body and hair while it is lit. Wait for 30 seconds after igniting and carefully blow out the flame. Place burning incense in holder. Never leave burning incense unattended!
Hanging Diffusers:
Remove product from packaging. Unscrew wood cap & remove plastic stopper. Place reed stick(s) in the bottle. Hang in desired location & enjoy the fragrance! Use 1 stick for small spaces or less fragrance, use 2 sticks for bigger spaces or more fragrance. Diffuser may last anywhere from 3-6 weeks depending on location, use and environment.
Body Oils:
Unscrew cap & apply perfume directly onto pulse points. Use caution while using as oil can cause stain on garments, fabrics & other sensitive material. Perfumed body oils are for external use only. Keep away from children and pets. Avoid contact with eyes & skin.
Bath Bombs:
Pick your favorite fragrance. Fill up your tub with water, at desired temperature. Drop in the bath bomb and enjoy!
Burning Oils:
For a higher concentration- Pour Blunteffects® burning oil into an aroma burner. Place a tea light candle if needed. If your burner is electric, plug it in and enjoy!
For a lighter concentration- Pour desired quantity of Blunteffects® burning oil and add a carrier oil such as almond, coconut or mineral oil. Place a tea light candle if needed. If your burner is electric, plug it in and enjoy!
Cloth Bag Air-Fresheners:
Remove bag from plastic packaging. Tie rope to desired area and enjoy the aroma! To restore freshness, simply place bag in the sun. Review in state laws before hanging in the car mirror. This product is a time sensitive product therefore place product in desired location promptly after opening.
Wax Melts & Candles:
Wax melts are quite simple to use. Just break a cube/s and light your tea light or turn on your heat warmer if your burner is electric. After 2-3 uses, replace your cube. This will give you a concentrated aroma at every use! The melt will simply solidify when its cooled. When using, use caution as this product involves the use of heat.
Place candle jar on heat resistant surface. To reduce possibility of smoking or soot build up, keep wick trimmed to 1/8” tall at all times. Do not let matches, wick trimmings, or debris accumulate in the jar; this could be a fire hazard. Burn candles approx. 3 to 4 hours until surface is liquid. Make certain wick is always centered and flame never touches glass. If flame smokes, extinguish, and shorten wick. Extinguish by placing the metal lid over the jar to minimize smoking. After wax hardens, wipe inside of jar with a paper towel to clean off residue. Burn until ¼ of wax is remaining and discard as glass may shatter. If misused, glass may crack or shatter. Use caution with electric candle warmers and crocks.
Natural Soy Candles can sometimes frost over a period. If you have ever seen a frosty, whitish color coating on chocolate, you have a good idea of what frosting looks like in soy wax. Since it is all natural, the frosting is a byproduct of soy wax. The good thing is that the frost does not affect the burn ability or fragrance of a candle. It is simply a small crystal growth that can form on the top and around the candle.
NOTICE & WARNING (for all products):
TO PREVENT FIRE, BURN CANDLE WITHIN SIGHT. NEVER ON OR NEAR ANYTHING THAT CAN CATCH FIRE. KEEP OUT OF REACH FROM CHILDREN AND PETS.
Keep away from children & pets. Strictly for external use only. Avoid direct contact with sunlight. Keep away from eyes, skin & hair. Spray/use with caution. Do not spray air-fresheners or fragranced products in air vents. Oil can stain/or damage fabric, leather, vinyl, plastic or any sensitive material. May cause surface to be slippery. Use with caution and remember, less is more!
All of our products are bottled and scented in the USA.